General Information

  • ID:  hor006536
  • Uniprot ID:  P22642
  • Protein name:  Ventricular natriuretic peptide
  • Gene name:  vnp
  • Organism:  Anguilla japonica (Japanese eel)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  Heart ventricle, and to a lower extent in heart atrium.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Anguilla (genus), Anguillidae (family), Anguilliformes (order), Elopomorpha , Elopocephala , Elopocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KSFNSCFGTRMDRIGSWSGLGCNSLKNGTKKKIFGN
  • Length:  36
  • Propeptide:  MAKSGIYLGCFILILIQNMVAANPLFNRNNVQELENLKDLIHQLEERVAVNEEPEVYPESEDMKMDAEEEDAGISPGALRQSEENLLMNIVDRIAPESPLRSRFRDLAGLAKTAKSFNSCFGTRMDRIGSWSGLGCNSLKNGTKKKIFGN
  • Signal peptide:  MAKSGIYLGCFILILIQNMVA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exhibits natriuretic and vasodepressor activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-22
  • Structure ID:  AF-P22642-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006536_AF2.pdbhor006536_ESM.pdb

Physical Information

Mass: 456498 Formula: C170H272N52O50S3
Absent amino acids: AEHPQVY Common amino acids: G
pI: 10.96 Basic residues: 7
Polar residues: 19 Hydrophobic residues: 8
Hydrophobicity: -63.33 Boman Index: -7351
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 43.33
Instability Index: 21.67 Extinction Coefficient cystines: 5625
Absorbance 280nm: 160.71

Literature

  • PubMed ID:  7893352
  • Title:  Eel ventricular natriuretic peptide: cDNA cloning and mRNA expression.
  • PubMed ID:  1828035
  • Title:  A novel natriuretic peptide isolated from eel cardiac ventricles.